PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG017500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 337aa    MW: 38144 Da    PI: 8.3411
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG017500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS239.21.8e-733314110374
                 GRAS 110 ervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL... 194
                          + v iiD++ s  ++ QW+ Ll+ +  R++gpp++R+T+v++    +++ l +++  L++ A++l++pf+f+  v  rle+l++++L   
  Pavir.3KG017500.1.p   3 KVVRIIDLSCStaHPWQWLKLLHDFHGRQGGPPEVRLTVVHD----DNDYLANMRILLSNEADKLKIPFQFSS-VIGRLETLDFSNLrnt 87 
                          6789****87633799**************************....9**************************.7999999999888544 PP

                 GRAS 195 .rvkpgEalaVnlvlqlhrll...........................................desvsleserdevLklvkslsPkvvv 240
                           ++k gEa+a++++lq+hrll                                           + + ++++   ++L++++ l+P+++ 
  Pavir.3KG017500.1.p  88 lDIKYGEAIAISCSLQMHRLLvvddkvscsgigqlqkmaniaqlkqmassvyspastlnypqtpSPQCKMPKLLATFLNAIRVLKPNIML 177
                          47777********************************************************99988888999999*************** PP

                 GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                          v+eq+a+hn+  F +rf+eal+yy+alfds++a ++++    +er+ vEr++lg+ei+n++ ceg +r erhe+l++W + ++++GF  v
  Pavir.3KG017500.1.p 178 VMEQDANHNALLFCDRFAEALNYYAALFDSFHAVVAANPrraDERAQVERMILGEEIKNILVCEGVHRHERHERLSQWAMHMDRSGFDHV 267
                          *******************************87764443344************************************************ PP

                 GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          pls +a  + +  l  ++ +g + + es++l+l+W +r L+s+SaWr
  Pavir.3KG017500.1.p 268 PLSFRAIWEGNQKLMGFGLNGCQSKVESDCLLLCWGSRHLYSISAWR 314
                          **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.1471294IPR005202Transcription factor GRAS
PfamPF035146.1E-713314IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MNKVVRIIDL SCSTAHPWQW LKLLHDFHGR QGGPPEVRLT VVHDDNDYLA NMRILLSNEA  60
DKLKIPFQFS SVIGRLETLD FSNLRNTLDI KYGEAIAISC SLQMHRLLVV DDKVSCSGIG  120
QLQKMANIAQ LKQMASSVYS PASTLNYPQT PSPQCKMPKL LATFLNAIRV LKPNIMLVME  180
QDANHNALLF CDRFAEALNY YAALFDSFHA VVAANPRRAD ERAQVERMIL GEEIKNILVC  240
EGVHRHERHE RLSQWAMHMD RSGFDHVPLS FRAIWEGNQK LMGFGLNGCQ SKVESDCLLL  300
CWGSRHLYSI SAWRPHKGSA SGSREHMLVQ PQRQII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1619314123375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619626.11e-172PREDICTED: scarecrow-like protein 3 isoform X1
TrEMBLA0A0A9C2J40.0A0A0A9C2J4_ARUDO; Uncharacterized protein
STRINGSi012421m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.15e-73scarecrow-like 3